Products

Croyez GMP ® TGF beta 1 (Transforming growth factor beta 1), Human

Transforming growth factor beta 1 (TGF beta 1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene.
No. Size Price Qty Status
C01088-GMP-100 100 ug $1,750.00 Inquiry
C01088-GMP-1000 1 mg $7,000.00 Inquiry
The price does not include shipping fee and tax. ORDER
Sequence:
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVY
YVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline
 
Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL.
The specific activity of recombinant human TGF beat 1 is approximately >5 x 107 IU/mg.
Measure by its ability to induce proliferation in MCF-7 cells The ED50 for this effect is <3.2 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
 
Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein.
 
Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.
 
Note:
Please use within one month after protein reconstitution.
 
Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life