Recombinant Human TGF beta 1 Protein
Transforming growth factor beta 1 or TGF-β1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene.
Sequence
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESA
EPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSN
RLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQ
SSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the N-terminus
UnitProt ID
P01137
Source
HEK293
Endotoxin Test
<0.1 EU per 1 μg of the protein by the LAL method.
Activity
Measure by its ability to inhibit the IL-4 dependent proliferation in TF-1 cells. The ED50 for this effect is < 0.1 ng/mL.
Purity
>95% as determined by SDS-PAGE.
Form
Lyophilized
Storage Buffer
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.0.
Reconstitution
It is recommended to reconstitute the lyophilized protein in 10 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions
Blue ice
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESA
EPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSN
RLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQ
SSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the N-terminus
UnitProt ID
P01137
Source
HEK293
Endotoxin Test
<0.1 EU per 1 μg of the protein by the LAL method.
Activity
Measure by its ability to inhibit the IL-4 dependent proliferation in TF-1 cells. The ED50 for this effect is < 0.1 ng/mL.
Purity
>95% as determined by SDS-PAGE.
Form
Lyophilized
Storage Buffer
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.0.
Reconstitution
It is recommended to reconstitute the lyophilized protein in 10 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions
Blue ice
Downloads
→ Materials For iPSC differentiation
Related Articles
→ [ Recombinant Protein ] Exploring the Diversity: Conventional T Cells Dance to Different Tunes of Immunity!
→ [ Recombinant Protein ] The Impact of Cytokines on NK Cells: Shaping Their Activity and Function
→ [ Recombinant Protein ] A spy: IL-1β induces acute inflammation to kill the cancer cells.
→ [ Recombinant Protein ] Exploring the Diversity: Conventional T Cells Dance to Different Tunes of Immunity!
→ [ Recombinant Protein ] A micromanager: granulocyte-macrophage colony-stimulating factor (GM-CSF) from growth factor to immune modulator
Related Product
→ Croyez GMP ® TGF beta 1 (Transforming growth factor beta 1), Human
→ Materials For iPSC differentiation
Related Articles
→ [ Recombinant Protein ] Exploring the Diversity: Conventional T Cells Dance to Different Tunes of Immunity!
→ [ Recombinant Protein ] The Impact of Cytokines on NK Cells: Shaping Their Activity and Function
→ [ Recombinant Protein ] A spy: IL-1β induces acute inflammation to kill the cancer cells.
→ [ Recombinant Protein ] Exploring the Diversity: Conventional T Cells Dance to Different Tunes of Immunity!
→ [ Recombinant Protein ] A micromanager: granulocyte-macrophage colony-stimulating factor (GM-CSF) from growth factor to immune modulator
Related Product
→ Croyez GMP ® TGF beta 1 (Transforming growth factor beta 1), Human


