Products

IL-12 p70 (Interleukin-12 p70), Human (mammalian cell expression)

Active IL-12 is a p70 disulfide-linked dimer composed of p35 and p40 subunits. The protein is a pleiotropic cytokine produced primarily by antigen presenting cells and has multiple effects on T lymphocytes and natural killer cells in terms of stimulating cytotoxicity, proliferation, production of other cytokines and Th1 subset differentiation.
No. Size Price Qty Status
C01178-5UG 5 ug $144.00 Out of stock
C01178-20UG 20 ug $360.00 Out of stock
C01178-100UG 100 ug $750.00 Out of stock
The price does not include shipping fee and tax. ORDER
Sequence:
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTD
ILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIE
VMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRK
NASISVRAQDRYYSSSWSEWASVPCSGSTSGSGKPGSGEGSTKGRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEI
DHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVI
DELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH

Source:
HEK293

Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method.

Purity:
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.

Activity:
Measure by its ability to induce IFN gamma secretion in PHA-activated human peripheral blood lymphocytes (PBMC).
The ED50 for this effect is 0.05-0.2 ng/mL.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage: 
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.

Note:
Please use within one month after protein reconstitution.