Products

Croyez GMP ® TPO (Thrombopoietin), Human

Thrombopoietin (TPO) is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets.
No. Size Price Qty Status
C01126-GMP-100 100 ug $1,750.00 Inquiry
C01126-GMP-1000 1 mg $7,000.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVR
LLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL with polyhistidine tag at the N-terminus

UnitProt ID:
P40225

Species of Origin:
Human
 
Expression System:
Escherichia coli

Endotoxin level:
<0.05 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <2 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE analysis.
 
Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions:
Blue ice
 

Background Information
Thrombopoietin (TPO) is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets.
 

Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
●  Animal-free reagent and laboratory 
●  Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Mycoplasma detection via PCR analysis.

We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.​