Croyez GMP ® IL-18 (Interleukin-18), Human
Interleukin-18 (IL-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the IL-18 receptor, and together with IL-12 that it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon gamma or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL-12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL-18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
✔️ Scarce GMP-certified Quality
✔️ Over 98% purity
✔️ Potent immunostimulatory activity
✔️ Wide range of applications
Newly Launched
→ Croyez GMP® Human IL-18 Protein, Tag Free, E. coli
MYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHD NKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED with polyhistidine tag at the C-terminus
UnitProt ID
Q14116
Species of Origin
Human
Expression System
Escherichia coli
Endotoxin Level
<0.05 EU per 1 μg of the protein by the LAL method.
Activity
Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <6 ng/mL
Purity
>98% as determined by SDS-PAGE analysis.
Form
Lyophilized
Storage Buffer
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping conditions
Blue ice
Background Information
Interleukin-18 (IL-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the IL-18 receptor, and together with IL-12 that it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon gamma or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL-12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL-18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Animal-free reagent and laboratory
● Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life
Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Mycoplasma detection via PCR analysis.
We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.
Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <6 ng/mL.
Downloads
→ Product Brochure
Related Products
→ IL-18 (Interleukin-18), Human
Selected Scholarly Works from Network for Your Insight:
NK Cell
→ A novel fusion protein scaffold 18/12/TxM activates the IL-12, IL-15, and IL-18 receptors to induce human memory-like natural killer cells
→ Effect of IL-18 on the Expansion and Phenotype of Human Natural Killer Cells: Application to Cancer Immunotherapy
→ Sustained effector function of IL-12/15/18-preactivated NK cells against established tumors
→ IFN-gamma-inducing factor up-regulates Fas ligand-mediated cytotoxic activity of murine natural killer cell clones.
→ Utilizing Cytokines to Function-Enable Human NK Cells for the Immunotherapy of Cancer
→ Effect of IL-18 on expansion of gammadelta T cells stimulated by zoledronate and IL-2
→ Effect of IL-18 on Expansion of γδ T Cells Stimulated by Zoledronate and IL-2
→ γδ T cells in tissue physiology and surveillance
→ Cytokine signaling in chimeric antigen receptor T-cell therapy
→ 12P IL-18 improves the anti-cancer immunity of human gamma delta T cells against prostate cancer
→ Function of γδ T cells in tumor immunology and their application to cancer therapy