Products

SCF, Human

Stem Cell Factor (SCF) is a stromal cell- derived cytokine synthesized by fibroblasts and other cell types. SCF promotes proliferation and early differentiation of cells at the level of multipotential stem cells. SCF is a growth factor important for proliferation, and differentiation of hematopoietic stem cells. One of its roles is to change the BFU-E (burst-forming unit-erythroid) cells, which are the earliest erythrocyte precursors in the erythrocytic series, into the CFU-E (colony-forming unit-erythroid).
No. Size Price Qty Status
C01177-5UG 5 ug $108.00 Inquiry
C01177-20UG 20 ug $268.00 Inquiry
C01177-100UG 100 ug $475.20 Inquiry
The price does not include shipping fee and tax. ORDER
Sequence:
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKE
NSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce TF-1 cells proliferation.
The ED50 for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 105 IU/mg.

Purity:
>98% as determined by SDS-PAGE.

Formulation:
The protein was lyophilized from a solution containing 1X PBS containing, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage: 
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.