SARS-CoV-2 Spike Protein (RBD), His-tag, E. coli
Recombinant SARS-CoV-2 Spike Protein, S1 Subunit, Host Cell Receptor Binding Domain (RBD) derived from E.coli .
Source :
Escherichia coli
Sequence :
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIA
PGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVG
YQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF with polyhistidine tag at the C-terminus.
Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.
Purity :
>98% as determined by SDS-PAGE.
Formulation :
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note :
Please use within one month after protein reconstitution.
Escherichia coli
Sequence :
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIA
PGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVG
YQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF with polyhistidine tag at the C-terminus.
Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.
Purity :
>98% as determined by SDS-PAGE.
Formulation :
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note :
Please use within one month after protein reconstitution.
Reviews for SARS-CoV-2 Spike Protein (RBD), His-tag, E. coli
Average Rating: 0 (0 Reviews )