Products

SARS-CoV-2 Spike Protein (RBD), His-tag, E. coli

Recombinant SARS-CoV-2 Spike Protein, S1 Subunit, Host Cell Receptor Binding Domain (RBD) derived from E.coli .
No. Size Price Qty Status
C11007-100UG 100 ug $500.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Source :
Escherichia coli

Sequence :
MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIA
PGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVG
YQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF with polyhistidine tag at the C-terminus.

Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.

Purity :
>98% as determined by SDS-PAGE.

Formulation :
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note :
Please use within one month after protein reconstitution.