Products

IL-15 (Interleukin-15), Human

Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells.
No. Size Price Qty Status
C01017-20UG 20 ug $268.00 Inquiry
C01017-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSF
VHIVQMFINTS with polyhistidine tag at the N-terminus

UnitProt ID:
P40933
 
Source:
Escherichia coli
 
Endotoxin level:
<0.01 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to induce proliferation in CTLL-2 cells. The ED50 for this effect is < 3 ng/mL.
The specific activity of recombinant human IL-15 is approximately  2.5 x 107 IU/mg.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution of NaPi buffer, 0.018% SDS, pH 7.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 6 months under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for IL-15 (Interleukin-15), Human

Average Rating: 0 (0 Reviews )