Products

CNTF (Ciliary neurotrophic factor), Mouse

The ciliary neurotrophic factor is a protein that in humans is encoded by the CNTF gene. It is a hypothalamic neuropeptide that is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. CNTF has also been shown to be expressed by cells on the bone surface and to reduce the activity of bone-forming cells (osteoblasts).
No. Size Price Qty Status
C02088-5UG 5 ug $108.00 Inquiry
C02088-20UG 20 ug $268.00 Inquiry
C02088-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLE
DQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHM
GISAHESHYGAKQM with polyhistidine tag at the Cterminus

UnitProt ID:
P51642
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <10 ng/mL. The specific activity of recombinant mouse CNTF is > 1 x 105 IU/mg.
 
Purity:

>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice