Products

CCL4 (C-C Motif Chemokine Ligand 4), Mouse

CCL4 act as an important pro-inflammatory cytokine during acute and chronic inflammatory responses. CCL4 also play a role as an attractant NK cells, dendritic cells, monocytes, and lymphocytes to sites of injury and inflammation. As CCL4 conducts signaling through G-protein-coupled receptor CCR5, which is a major co-receptor for M-tropic HIV strains. Thus, binding of CCL4 to CCR5 inhibits HIV entry and reduces the cell surface expression of CCR5. CCL4 has been identified as one of the major anti-HIV factors produced by CD8+ T cells.
No. Size Price Qty Status
C02086-5UG 5 ug $108.00 Inquiry
C02086-20UG 20 ug $268.00 Inquiry
C02086-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. ORDER
Sequence: 
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <4 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.