Products

CXCL2 (C-X-C motif chemokine 2), Mouse

CXCL2 is an ELR CXC chemokine. The structural and functional characteritics of CSCL2 have relationship with with GRO1 (CXCL1), GRO3 (CXCL3), and interleukin-8 (CXCL8). It is produced by activated monocytes, neutrophils and macrophages. In addition, it also expresses at sites of inflammation. It has been detected that CXCL2 is highly expressed in serum of patients with the disease “esophageal squamous cell carcinoma” (ESCC) .
No. Size Price Qty Status
C02074-5UG 5 ug $108.00 Inquiry
C02074-20UG 20 ug $268.00 Inquiry
C02074-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. ORDER
Sequence: 
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN with polyhistidine tag at the N-terminus
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <0.5 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.