Products

IL-34 (Interleukin-34), Mouse

Interleukin-34 (IL-34) is a protein that promotes the proliferation, survival and differentiation of monocytes and macrophages. It also promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. IL-34 plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1.
No. Size Price Qty Status
C02036-20UG 20 ug $268.00 Inquiry
C02036-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MNENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYMKHYFPINYRIAVPYEGVLRVANITRLQKAHVSERELRYLWVLVSLNATESVMDVLLE
GHPSWKYLQEVQTLLENVQRSLMDVEIGPHVEAVLSLLSTPGLSLKLVRPKALLDNCFRVMELLYCSCCKQSPILKWQDCELPRLHPHSPG
SLMQCTATNVYPLSRQTPTSLPGSPSSSHGSLP with polyhistidine tag at the C-terminus

UnitProt ID:
Q8R1R4
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <30 ng/mL. The specific activity of recombinant mouse IL-34 is > 3.3 x 104 IU/mg.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for IL-34 (Interleukin-34), Mouse

Average Rating: 0 (0 Reviews )