Products

VEGF165 (Vascular endothelial growth factor 165), Human

Vascular endothelial growth factor (VEGF), originally known as vascular permeability factor (VPF), is a signal protein produced by cells that stimulates the formation of blood vessels. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells. In adults, VEGF functions mainly in wound healing and the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels correlate with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis and systemic lupus erythematosus. VEGF is induced by hypoxia and cytokines such as IL-1, IL-6, IL-8, oncostatin M and TNF-alpha.

✔️ Promotes angiogenesis
✔️ High purity
✔️ Regulated production
✔️ Long-lasting stability
✔️ Versatile applications 
✔️ Highly cost-effective
No. Size Price Qty Status
C01125-5UG 5 ug $108.00 Inquiry
C01125-20UG 20 ug $268.00 Inquiry
C01125-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence
MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQH
IGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine
tag at the C-terminus

UnitProt ID
NP_001165097
 
Source
Escherichia coli

Endotoxin Test
<0.1 EU per 1 μg of the protein by the LAL method.

Activity
Measure by its ability to induce HUVEC cells proliferation. The ED50 for this effect is <5 ng/mL. The specific activity of recombinant human VEGF165 is approximately >1.4 x 106 IU/mg.

Purity
>98% as determined by SDS-PAGE. 

Form
Lyophilized

Storage Buffer
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions
Blue ice


Measure by its ability to induce HUVEC cells proliferation. The ED50 for this effect is <5 ng/mL.
The specific activity of recombinant human VEGF165 is approximately >1.4 x 106 IU/mg.