Products

Midkine, Human

Midkine (MK or MDK) also known as neurite growth-promoting factor 2 (NEGF2) is a protein that in humans is encoded by the MDK gene. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis. Midkine exhibited increased expression in the breast carcinomas but showed much lower expression in the normal breast tissue.
No. Size Price Qty Status
C01152-20UG 20 ug $268.00 Inquiry
C01152-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTL
KKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD with polyhistidine tag at the C-terminus

UnitProt ID:
P21741
 
Source:
Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.
 
Purity:
>95% as determined by SDS-PAGE analysis. 
>95% as determined by SEC-HPLC.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice

  The purity of hMidkine is greater than 95% as determined by SEC-HPLC.
Reviews for Midkine, Human

Average Rating: 0 (0 Reviews )