Midkine, Human
Midkine (MK or MDK) also known as neurite growth-promoting factor 2 (NEGF2) is a protein that in humans is encoded by the MDK gene. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis. Midkine exhibited increased expression in the breast carcinomas but showed much lower expression in the normal breast tissue.
Sequence:
MVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTL
KKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD with polyhistidine tag at the C-terminus
UnitProt ID:
P21741
Source:
Escherichia coli
Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.
Purity:
>95% as determined by SDS-PAGE analysis.
>95% as determined by SEC-HPLC.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTL
KKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD with polyhistidine tag at the C-terminus
UnitProt ID:
P21741
Source:
Escherichia coli
Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.
Purity:
>95% as determined by SDS-PAGE analysis.
>95% as determined by SEC-HPLC.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
The purity of hMidkine is greater than 95% as determined by SEC-HPLC.


