BDNF (Brain-derived neurotrophic factor),Human
BDNF, also known as Brain-derived neurotrophic factor, is encoded by the BDNF Gene in human. BDNF is a member of the neurotrophin family of growth factors, which are related to the canonical nerve growth factor. Neurotrophic factors are found in the brain and the periphery. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
Sequence:
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRA
LTMDSKKRIGWRFIRIDTSCVCTLTIKRGR with polyhistidine tag at the C-terminus
UnitProt ID:
P23560
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce proliferation in BaF3 cells transfected with TrkB. The ED50 for this effect is <2 ng/mL.
Purity:
>98% as determined by SDS-PAGE.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRA
LTMDSKKRIGWRFIRIDTSCVCTLTIKRGR with polyhistidine tag at the C-terminus
UnitProt ID:
P23560
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce proliferation in BaF3 cells transfected with TrkB. The ED50 for this effect is <2 ng/mL.
Purity:
>98% as determined by SDS-PAGE.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice