Products

IFN beta 1a (Interferon β1a), Human

Interferon-beta is, a cytokine, released by fibroblasts and pathogen-exposed dendritic cells, macrophages, and endothelial cells. IFN beta 1a conducts through the heterodimeric IFN-alpha/beta Receptor. IFN-beta-deficient mice are easier to suffer from experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS).In addition, IFN-beta has been proved to suppress the Th17 cell response in both MS and EAE and is usually used to treat MS disease.
No. Size Price Qty Status
C01079-20UG 20 ug $268.00 Inquiry
C01079-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVY
HQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN with polyhistidine tag at
the C-terminus

UnitProt ID:
P01574
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce apoptosis in HeLa cells. The ED50 for this effect is <15 ng/mL.
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is <0.1 ng/mL. The specific activity of recombinant human IFN beta 1a is approximately >1 x107 IU/mg.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Yu-Lin Chen, Amir Yousif, Chung-Hsing Chen, Ava Lowin, Abbey A Saadey, Ssu-Han Wang, Shih Sheng Jiang, Ya-Wen Chen, Hazem E Ghoneim. Chronic ISG15 Exposure Accelerates CD8+ T-cell Dysfunction while Increasing PD-1 Blockade Sensitivity in Oral Squamous Cell Carcinoma. Cancer Immunol Res. 2025 Nov 3;13(11):1829-1844.
Reviews for IFN beta 1a (Interferon β1a), Human

Average Rating: 0 (0 Reviews )