Products

SARS-CoV-2 Nucleocapsid Protein, E. coli

The E.Coli derived recombinant protein contains the SARS-CoV-2 full-length nucleoprotein: Gene bank- MN908947, fused to His tag at C-terminal and having a Mw. Of 48 kDa as appears on SDS-PAGE.
No. Size Price Qty Status
C11005-100UG 100 ug $472.00 In stock
The price does not include shipping fee and tax. ORDER

Source :
Escherichia coli

Sequence :
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRR
ATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQ
ASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKPRQKRTATKAYNVT
QAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYK
TFPPTEPKKDKKKKADETQALPRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.

Purity :
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation :
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note :
Please use within one month after protein reconstitution.