Products

  • HOME
  • PRODUCTS
  • COVID-19
  • SARS-CoV-2 Nucleocapsid Protein, His-SUMO tag, HEK293

SARS-CoV-2 Nucleocapsid Protein, His-SUMO tag, HEK293

Nucleocapsid protein (NP) packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. NP also plays an important role in enhancing the efficiency of sub-genomic viral RNA transcription as well as viral replication. This product is composed of a DNA sequence encoding SARS-CoV-2 NP and a polyhistidine-SUMO tag at the N-terminus.
No. Size Price Qty Status
C11004-5UG 5 ug $114.00
C11004-20UG 20 ug $212.00
C11004-100UG 100 ug $636.00
The price does not include shipping fee and tax. ORDER

Source :
HEK293

Sequence :
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRR
ATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQ
ASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKPRQKRTATKAYNVT
QAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKT
FPPTEPKKDKKKKADETQALPRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA with polyhistidine-SUMO tag at the N-terminus.

Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.

Purity :
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation :
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note :
Please use within one month after protein reconstitution.